HORDB

ID: hor006379
Uniprot ID: P01304
Protein name: C-flanking peptide of NPY
Gene name: NPY
Organism: Sus scrofa (Pig)
Family: NPY family
Source: animal
Expression: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0008343 adult feeding behavior; GO:0032100 positive regulation of appetite
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0098992 neuronal dense core vesicle

Sequence: SSPETLISDLLMREGTENVPRTRLEDPS
Length: 28
Propeptide: VCLCALAEAYPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRYGKRSSPETLISDLLMREGTENVPRTRLEDPS
Signal peptide: VCLCALAEA
Modification: T16 Phosphothreonine
Glycosylation: NA
Mutagenesis: NA

Function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Mechanism: NA
Cross BBB: NA
Target: NPY1R
Target Unid: O02835
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006379_AF2.pdb

hor006379_ESM.pdb

Mass:	362522	Formula:	C131H220N38O49S
Absent amino acids:	ACFHKQWY	Common amino acids:	ELS
pI:	4.1	Basic residues:	3
Polar residues:	9	Hydrophobic residues:	6
Hydrophobicity:	-81.07	Boman Index:	-8546
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	80
Instability Index:	5751.79	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 6957876
Title: Neuropeptide Y: complete amino acid sequence of the brain peptide.
PubMed ID: 2372534
Title: Sequence-specific 1H NMR assignment and secondary structure of neuropeptide Y in aqueous solution.
PubMed ID: 1576993
Title: Structure of neuropeptide Y dimer in solution.